Lineage for d1lq0a1 (1lq0 A:22-266,A:335-386)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305661Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 306351Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 306415Protein Chitotriosidase [82251] (1 species)
  7. 306416Species Human (Homo sapiens) [TaxId:9606] [82252] (4 PDB entries)
  8. 306418Domain d1lq0a1: 1lq0 A:22-266,A:335-386 [84672]
    Other proteins in same PDB: d1lq0a2

Details for d1lq0a1

PDB Entry: 1lq0 (more details), 2.2 Å

PDB Description: crystal structure of human chitotriosidase at 2.2 angstrom resolution

SCOP Domain Sequences for d1lq0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lq0a1 c.1.8.5 (A:22-266,A:335-386) Chitotriosidase {Human (Homo sapiens)}
aklvcyftnwaqyrqgearflpkdldpslcthliyafagmtnhqlsttewndetlyqefn
glkkmnpklktllaiggwnfgtqkftdmvatannrqtfvnsairflrkysfdgldldwey
pgsqgspavdkerfttlvqdlanafqqeaqtsgkerlllsaavpagqtyvdagyevdkia
qnldfvnlmaydfhgswekvtghnsplykrqeesgaaaslnvdaavqqwlqkgtpaskli
lgmptXddvesfktkvsylkqkglggamvwaldlddfagfscnqgrypliqtlrqels

SCOP Domain Coordinates for d1lq0a1:

Click to download the PDB-style file with coordinates for d1lq0a1.
(The format of our PDB-style files is described here.)

Timeline for d1lq0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lq0a2