SCOPe 2.06: Domain d1lojj1: 1loj J:11-80

Lineage for d1lojj1 (1loj J:11-80)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
   forms homo and heteroheptameric ring structures

6. Protein Archaeal homoheptameric Sm protein [63758] (6 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (5 PDB entries)
   MTH649, smap1

8. Domain d1lojj1: 1loj J:11-80 [84659]
   Other proteins in same PDB: d1loja2, d1lojb2, d1lojc2, d1lojd2, d1loje2, d1lojf2, d1lojg2, d1lojh2, d1loji2, d1lojj2, d1lojk2, d1lojl2, d1lojm2, d1lojn2
   complexed with mpd, u, uri

Details for d1lojj1

PDB Entry: 1loj, 1.9 Å

PDB Description: Crystal structure of a Methanobacterial Sm-like archaeal protein (SmAP1) bound to uridine-5'-monophosphate (UMP)

PDB Compounds: (J:) small nuclear ribonucleoprotein homolog (Sm-like)

SCOPe Domain Sequences for d1lojj1:

Sequence; same for both SEQRES and ATOM records:

>d1lojj1 b.38.1.1 (J:11-80) Archaeal homoheptameric Sm protein {Methanobacterium thermoautotrophicum [TaxId: 145262]}
vqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtvl
irgdnivyis

Timeline for d1lojj1:

• d1lojj1 first appeared in SCOP 1.65, called d1lojj_
  
• d1lojj1 was called d1lojj_ in SCOPe 2.05
  
• d1lojj1 appears in SCOPe 2.07
  
• d1lojj1 appears in the current release, SCOPe 2.08