Lineage for d1lojb1 (1loj B:11-80)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2786772Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 2786773Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 2786819Species Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (5 PDB entries)
    MTH649, smap1
  8. 2786835Domain d1lojb1: 1loj B:11-80 [84651]
    Other proteins in same PDB: d1loja2, d1lojb2, d1lojc2, d1lojd2, d1loje2, d1lojf2, d1lojg2, d1lojh2, d1loji2, d1lojj2, d1lojk2, d1lojl2, d1lojm2, d1lojn2
    complexed with mpd, u, uri

Details for d1lojb1

PDB Entry: 1loj (more details), 1.9 Å

PDB Description: Crystal structure of a Methanobacterial Sm-like archaeal protein (SmAP1) bound to uridine-5'-monophosphate (UMP)
PDB Compounds: (B:) small nuclear ribonucleoprotein homolog (Sm-like)

SCOPe Domain Sequences for d1lojb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lojb1 b.38.1.1 (B:11-80) Archaeal homoheptameric Sm protein {Methanobacterium thermoautotrophicum [TaxId: 145262]}
vqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtvl
irgdnivyis

SCOPe Domain Coordinates for d1lojb1:

Click to download the PDB-style file with coordinates for d1lojb1.
(The format of our PDB-style files is described here.)

Timeline for d1lojb1: