Lineage for d1lnxc_ (1lnx C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2396390Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2396391Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2396392Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 2396393Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 2396489Species Pyrobaculum aerophilum [TaxId:13773] [63760] (2 PDB entries)
    smap1
  8. 2396499Domain d1lnxc_: 1lnx C: [84644]
    Other proteins in same PDB: d1lnxa2, d1lnxf2
    complexed with acy, gol, uri

Details for d1lnxc_

PDB Entry: 1lnx (more details), 2.05 Å

PDB Description: Crystal structure of the P.aerophilum SmAP1 heptamer in a new crystal form (C2221)
PDB Compounds: (C:) small nuclear ribonucleoprotein homolog (Sm-like)

SCOPe Domain Sequences for d1lnxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnxc_ b.38.1.1 (C:) Archaeal homoheptameric Sm protein {Pyrobaculum aerophilum [TaxId: 13773]}
cfatlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnvykrgtmv
vrgenvlfispvp

SCOPe Domain Coordinates for d1lnxc_:

Click to download the PDB-style file with coordinates for d1lnxc_.
(The format of our PDB-style files is described here.)

Timeline for d1lnxc_: