SCOPe 2.08: Domain d1lnxa1: 1lnx A:8-80

Lineage for d1lnxa1 (1lnx A:8-80)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
   forms homo and heteroheptameric ring structures
   Pfam PF01423

6. Protein Archaeal homoheptameric Sm protein [63758] (6 species)

7. Species Pyrobaculum aerophilum [TaxId:13773] [63760] (2 PDB entries)
   smap1

8. Domain d1lnxa1: 1lnx A:8-80 [84642]
   Other proteins in same PDB: d1lnxa2, d1lnxf2
   complexed with acy, gol, uri

Details for d1lnxa1

PDB Entry: 1lnx, 2.05 Å

PDB Description: Crystal structure of the P.aerophilum SmAP1 heptamer in a new crystal form (C2221)

PDB Compounds: (A:) small nuclear ribonucleoprotein homolog (Sm-like)

SCOPe Domain Sequences for d1lnxa1:

Sequence; same for both SEQRES and ATOM records:

>d1lnxa1 b.38.1.1 (A:8-80) Archaeal homoheptameric Sm protein {Pyrobaculum aerophilum [TaxId: 13773]}
cfatlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnvykrgtmv
vrgenvlfispvp

Timeline for d1lnxa1:

• d1lnxa1 first appeared in SCOP 1.65, called d1lnxa_
  
• d1lnxa1 appears in SCOPe 2.07