Lineage for d1lmja1 (1lmj A:3-46)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 747016Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 747704Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 747705Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 747896Protein Fibrillin-1 [57227] (1 species)
    duplication: contains 47 EFG-like domains
  7. 747897Species Human (Homo sapiens) [TaxId:9606] [57228] (7 PDB entries)
  8. 747914Domain d1lmja1: 1lmj A:3-46 [84631]

Details for d1lmja1

PDB Entry: 1lmj (more details)

PDB Description: nmr study of the fibrillin-1 cbegf12-13 pair of ca2+ binding epidermal growth factor-like domains
PDB Compounds: (A:) fibrillin 1

SCOP Domain Sequences for d1lmja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}
tdidecrispdlcgrgqcvntpgdfeckcdegyesgfmmmkncm

SCOP Domain Coordinates for d1lmja1:

Click to download the PDB-style file with coordinates for d1lmja1.
(The format of our PDB-style files is described here.)

Timeline for d1lmja1:

747914
d1lmja1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1lmja2