Lineage for d1lmja1 (1lmj A:3-46)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 341571Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (18 superfamilies)
    disulphide-bound fold; contains beta-hairpin with two adjacent disulphides
  4. 342099Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 342100Family g.3.11.1: EGF-type module [57197] (20 proteins)
  6. 342211Protein Fibrillin-1 [57227] (1 species)
    duplication: contains 47 EFG-like domains
  7. 342212Species Human (Homo sapiens) [TaxId:9606] [57228] (3 PDB entries)
  8. 342215Domain d1lmja1: 1lmj A:3-46 [84631]

Details for d1lmja1

PDB Entry: 1lmj (more details)

PDB Description: nmr study of the fibrillin-1 cbegf12-13 pair of ca2+ binding epidermal growth factor-like domains

SCOP Domain Sequences for d1lmja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens)}
tdidecrispdlcgrgqcvntpgdfeckcdegyesgfmmmkncm

SCOP Domain Coordinates for d1lmja1:

Click to download the PDB-style file with coordinates for d1lmja1.
(The format of our PDB-style files is described here.)

Timeline for d1lmja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lmja2