Lineage for d1li4a2 (1li4 A:3-189,A:353-432)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390873Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 391407Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 391472Family c.23.12.3: S-adenosylhomocystein hydrolase [52300] (1 protein)
  6. 391473Protein S-adenosylhomocystein hydrolase [52301] (2 species)
    contains additional secondary structures disguising the superfamily fold
  7. 391474Species Human (Homo sapiens) [TaxId:9606] [52302] (2 PDB entries)
  8. 391475Domain d1li4a2: 1li4 A:3-189,A:353-432 [84617]
    Other proteins in same PDB: d1li4a1
    complexed with ipa, nah, noc

Details for d1li4a2

PDB Entry: 1li4 (more details), 2.01 Å

PDB Description: Human S-adenosylhomocysteine hydrolase complexed with neplanocin

SCOP Domain Sequences for d1li4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1li4a2 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystein hydrolase {Human (Homo sapiens)}
dklpykvadiglaawgrkaldiaenempglmrmrerysaskplkgariagclhmtvetav
lietlvtlgaevqwsscnifstqdhaaaaiakagipvyawkgetdeeylwcieqtlyfkd
gplnmilddggdltnlihtkypqllpgirgiseetttgvhnlykmmangilkvpainvnd
svtkskfXhpsfvmsnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnv
kltkltekqaqylgmscdgpfkpdhyry

SCOP Domain Coordinates for d1li4a2:

Click to download the PDB-style file with coordinates for d1li4a2.
(The format of our PDB-style files is described here.)

Timeline for d1li4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1li4a1