| Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) ![]() |
| Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins) this domain interrupts the other domain which defines family |
| Protein S-adenosylhomocystein hydrolase [51845] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [51846] (2 PDB entries) |
| Domain d1li4a1: 1li4 A:190-352 [84616] Other proteins in same PDB: d1li4a2 complexed with ipa, nah, noc |
PDB Entry: 1li4 (more details), 2.01 Å
SCOP Domain Sequences for d1li4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens)}
dnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviiteidpina
lqaamegyevttmdeacqegnifvtttgcidiilgrhfeqmkddaivcnighfdveidvk
wlnenavekvnikpqvdryrlkngrriillaegrlvnlgcamg
Timeline for d1li4a1: