SCOP 1.75: Domain d1lhzb1: 1lhz B:1-112

Lineage for d1lhzb1 (1lhz B:1-112)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Human (Homo sapiens), cluster 4 [TaxId:9606] [88539] (23 PDB entries)

8. Domain d1lhzb1: 1lhz B:1-112 [84614]
   Other proteins in same PDB: d1lhza2, d1lhzb2
   part of amyloidogenic protein BUR
   complexed with pca

Details for d1lhzb1

PDB Entry: 1lhz, 2.3 Å

PDB Description: structure of a human bence-jones dimer crystallized in u.s. space shuttle mission sts-95: 293k

PDB Compounds: (B:) immunoglobulin lambda light chain

SCOP Domain Sequences for d1lhzb1:

Sequence; same for both SEQRES and ATOM records:

>d1lhzb1 b.1.1.1 (B:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]}
etaltqpasvsgspgqsitvsctgvssivgsynlvswyqqhpgkapklltyevnkrpsgv
sdrfsgsksgnsasltisglqaedeadyycssydgsstsvvfgggtkltvlg

Timeline for d1lhzb1:

• d1lhzb1 first appeared in SCOP 1.65
  
• d1lhzb1 appears in SCOP 1.73
  
• d1lhzb1 appears in SCOPe 2.01
  
• d1lhzb1 appears in the current release, SCOPe 2.08