SCOPe 2.08: Domain d1lhza2: 1lhz A:113-214

Lineage for d1lhza2 (1lhz A:113-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88572] (47 PDB entries)

8. Domain d1lhza2: 1lhz A:113-214 [84613]
   Other proteins in same PDB: d1lhza1, d1lhzb1
   part of amyloidogenic protein BUR

Details for d1lhza2

PDB Entry: 1lhz, 2.3 Å

PDB Description: structure of a human bence-jones dimer crystallized in u.s. space shuttle mission sts-95: 293k

PDB Compounds: (A:) immunoglobulin lambda light chain

SCOPe Domain Sequences for d1lhza2:

Sequence; same for both SEQRES and ATOM records:

>d1lhza2 b.1.1.2 (A:113-214) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

Timeline for d1lhza2:

• d1lhza2 first appeared in SCOP 1.65
  
• d1lhza2 appears in SCOPe 2.07