Lineage for d1lffa_ (1lff A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 286043Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulphide-linked, and a calcium-binding loop
  4. 286044Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 286049Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 286123Protein Snake phospholipase A2 [48624] (27 species)
  7. 286173Species Indian cobra (Naja naja sagittifera), acidic isoform 1 [TaxId:195058] [89168] (1 PDB entry)
  8. 286174Domain d1lffa_: 1lff A: [84603]
    complexed with acy, ca, po4

Details for d1lffa_

PDB Entry: 1lff (more details), 1.5 Å

PDB Description: Crystal Structure of an Acidic Phospholipase A2 from Naja naja sagittifera at 1.5 A Resolution

SCOP Domain Sequences for d1lffa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lffa_ a.133.1.2 (A:) Snake phospholipase A2 {Indian cobra (Naja naja sagittifera), acidic isoform 1}
nlyqfknmidctvpsrswedfadygcycggggsgtpvdkldrccqvhdncyneaenisgc
rpyfktysyecsqgtltckgdnnacaasvcdcdrlaaicfagapynlanynidlkarck

SCOP Domain Coordinates for d1lffa_:

Click to download the PDB-style file with coordinates for d1lffa_.
(The format of our PDB-style files is described here.)

Timeline for d1lffa_:

  • d1lffa_ is new in SCOP 1.65
  • d1lffa_ became obsolete in SCOP 1.67