Lineage for d1leia1 (1lei A:192-291)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 291481Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 291482Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (5 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 291505Protein p65 subunit of NF-kappa B (NFKB), dimerization domain [49253] (3 species)
  7. 291516Species Mouse (Mus musculus) [TaxId:10090] [49254] (10 PDB entries)
  8. 291528Domain d1leia1: 1lei A:192-291 [84599]
    Other proteins in same PDB: d1leia2, d1leib1, d1leib2
    complexed with 5it

Details for d1leia1

PDB Entry: 1lei (more details), 2.7 Å

PDB Description: the kb dna sequence from the hlv-ltr functions as an allosteric regulator of hiv transcription

SCOP Domain Sequences for d1leia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1leia1 b.1.18.1 (A:192-291) p65 subunit of NF-kappa B (NFKB), dimerization domain {Mouse (Mus musculus)}
aelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvaiv
frtppyadpslqapvrvsmqlrrpsdrelsepmefqylpd

SCOP Domain Coordinates for d1leia1:

Click to download the PDB-style file with coordinates for d1leia1.
(The format of our PDB-style files is described here.)

Timeline for d1leia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1leia2