Lineage for d1le9e1 (1le9 E:192-291)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 456110Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 456111Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (6 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 456146Protein p65 subunit of NF-kappa B (NFKB), dimerization domain [49253] (3 species)
  7. 456157Species Mouse (Mus musculus) [TaxId:10090] [49254] (10 PDB entries)
  8. 456174Domain d1le9e1: 1le9 E:192-291 [84595]
    Other proteins in same PDB: d1le9a2, d1le9b1, d1le9b2, d1le9e2, d1le9f1, d1le9f2

Details for d1le9e1

PDB Entry: 1le9 (more details), 3 Å

PDB Description: crystal structure of a nf-kb heterodimer bound to the ig/hiv-kb siti

SCOP Domain Sequences for d1le9e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1le9e1 b.1.18.1 (E:192-291) p65 subunit of NF-kappa B (NFKB), dimerization domain {Mouse (Mus musculus)}
aelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvaiv
frtppyadpslqapvrvsmqlrrpsdrelsepmefqylpd

SCOP Domain Coordinates for d1le9e1:

Click to download the PDB-style file with coordinates for d1le9e1.
(The format of our PDB-style files is described here.)

Timeline for d1le9e1: