Lineage for d1le5f2 (1le5 F:38-250)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 659309Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 659552Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 659607Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins)
  6. 659611Protein p50 subunit of NF-kappa B (NFKB), N-terminal domain [49423] (2 species)
  7. 659614Species Mouse (Mus musculus) [TaxId:10090] [49425] (7 PDB entries)
  8. 659623Domain d1le5f2: 1le5 F:38-250 [84590]
    Other proteins in same PDB: d1le5a1, d1le5a2, d1le5b1, d1le5e1, d1le5e2, d1le5f1

Details for d1le5f2

PDB Entry: 1le5 (more details), 2.75 Å

PDB Description: crystal structure of a nf-kb heterodimer bound to an ifnb-kb
PDB Compounds: (F:) nuclear factor nf-kappa-b p50 subunit

SCOP Domain Sequences for d1le5f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1le5f2 b.2.5.3 (F:38-250) p50 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
mgpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivql
vtngknihlhahslvgkhcedgvctvtagpkdmvvgfanlgilhvtkkkvfetlearmte
acirgynpgllvhsdlaylqaegggdrqltdrekeiirqaavqqtkemdlsvvrlmftaf
lpdstgsftrrlepvvsdaiydskapnasnlki

SCOP Domain Coordinates for d1le5f2:

Click to download the PDB-style file with coordinates for d1le5f2.
(The format of our PDB-style files is described here.)

Timeline for d1le5f2: