SCOP 1.65: Domain d1le5f1: 1le5 F:251-350

Lineage for d1le5f1 (1le5 F:251-350)

Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.18: E set domains [81296] (18 families)
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (5 proteins)
subgroup of the larger IPT/TIG domain family
Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)
Species Mouse (Mus musculus) [TaxId:10090] [49250] (8 PDB entries)
Domain d1le5f1: 1le5 F:251-350 [84589]
Other proteins in same PDB: d1le5a1, d1le5a2, d1le5b2, d1le5e1, d1le5e2, d1le5f2

Details for d1le5f1

PDB Entry: 1le5 (more details), 2.75 Å

PDB Description: crystal structure of a nf-kb heterodimer bound to an ifnb-kb

SCOP Domain Sequences for d1le5f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1le5f1 b.1.18.1 (F:251-350) p50 subunit of NF-kappa B transcription factor {Mouse (Mus musculus)}
vrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrqfaiv
fktpkykdvnitkpasvfvqlrrksdletsepkpflyype

SCOP Domain Coordinates for d1le5f1:

Click to download the PDB-style file with coordinates for d1le5f1.
(The format of our PDB-style files is described here.)

Timeline for d1le5f1: