Class b: All beta proteins [48724] (174 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (7 families) |
Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins) |
Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [49429] (8 PDB entries) |
Domain d1le5e2: 1le5 E:18-191 [84588] Other proteins in same PDB: d1le5a1, d1le5b1, d1le5b2, d1le5e1, d1le5f1, d1le5f2 |
PDB Entry: 1le5 (more details), 2.75 Å
SCOP Domain Sequences for d1le5e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1le5e2 b.2.5.3 (E:18-191) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} mayveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislv tkdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtn nnpfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapnt
Timeline for d1le5e2: