SCOP 1.65: Domain d1le5b2: 1le5 B:38-250

Lineage for d1le5b2 (1le5 B:38-250)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (6 families)

5. Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins)

6. Protein p50 subunit of NF-kappa B (NFKB), N-terminal domain [49423] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49425] (6 PDB entries)

8. Domain d1le5b2: 1le5 B:38-250 [84586]
   Other proteins in same PDB: d1le5a1, d1le5a2, d1le5b1, d1le5e1, d1le5e2, d1le5f1

Details for d1le5b2

PDB Entry: 1le5, 2.75 Å

PDB Description: crystal structure of a nf-kb heterodimer bound to an ifnb-kb

SCOP Domain Sequences for d1le5b2:

Sequence; same for both SEQRES and ATOM records:

>d1le5b2 b.2.5.3 (B:38-250) p50 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus)}
mgpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivql
vtngknihlhahslvgkhcedgvctvtagpkdmvvgfanlgilhvtkkkvfetlearmte
acirgynpgllvhsdlaylqaegggdrqltdrekeiirqaavqqtkemdlsvvrlmftaf
lpdstgsftrrlepvvsdaiydskapnasnlki

Timeline for d1le5b2:

• d1le5b2 is new in SCOP 1.65
  
• d1le5b2 appears in SCOP 1.67
  
• d1le5b2 appears in the current release, SCOPe 2.08