Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (2 families) contains similar fold but lacks its catalytic centre |
Family d.92.2.2: alpha-D-glucuronidase, N-terminal domain [82737] (1 protein) family GH67 |
Protein alpha-D-glucuronidase, N-terminal domain [82738] (2 species) inverting reaction mechanism |
Species Bacillus stearothermophilus [TaxId:1422] [82740] (4 PDB entries) |
Domain d1l8na2: 1l8n A:4-142 [84565] Other proteins in same PDB: d1l8na1 complexed with gcw, gol, xyp |
PDB Entry: 1l8n (more details), 1.5 Å
SCOP Domain Sequences for d1l8na2:
Sequence, based on SEQRES records: (download)
>d1l8na2 d.92.2.2 (A:4-142) alpha-D-glucuronidase, N-terminal domain {Bacillus stearothermophilus} gyepcwlryerkdqysrlrfeeivakrtspifqaaveelqkglrsmmeiepqvvqevnet ansiwlgtledeeferplegtlvhpegyvirsdvddgpfriyiigktdagvlygvfhflr llqmgeniaqlsiieqpkn
>d1l8na2 d.92.2.2 (A:4-142) alpha-D-glucuronidase, N-terminal domain {Bacillus stearothermophilus} gyepcwlryerkdqysrlrfeeivakrtspifqaaveelqkglrsmmeiepqvvqevnet ansiwlgtledeeferplegtlvhpegyvirsdvdpfriyiigktdagvlygvfhflrll qmgeniaqlsiieqpkn
Timeline for d1l8na2: