SCOP 1.65: Domain d1l8na2: 1l8n A:4-142

Lineage for d1l8na2 (1l8n A:4-142)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (2 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.2: alpha-D-glucuronidase, N-terminal domain [82737] (1 protein)
   family GH67

6. Protein alpha-D-glucuronidase, N-terminal domain [82738] (2 species)
   inverting reaction mechanism

7. Species Bacillus stearothermophilus [TaxId:1422] [82740] (4 PDB entries)

8. Domain d1l8na2: 1l8n A:4-142 [84565]
   Other proteins in same PDB: d1l8na1
   complexed with gcw, gol, xyp

Details for d1l8na2

PDB Entry: 1l8n, 1.5 Å

PDB Description: the 1.5a crystal structure of alpha-d-glucuronidase from bacillus stearothermophilus t-1, complexed with 4-o-methyl-glucuronic acid and xylotriose

SCOP Domain Sequences for d1l8na2:

Sequence, based on SEQRES records:

>d1l8na2 d.92.2.2 (A:4-142) alpha-D-glucuronidase, N-terminal domain {Bacillus stearothermophilus}
gyepcwlryerkdqysrlrfeeivakrtspifqaaveelqkglrsmmeiepqvvqevnet
ansiwlgtledeeferplegtlvhpegyvirsdvddgpfriyiigktdagvlygvfhflr
llqmgeniaqlsiieqpkn

Sequence, based on observed residues (ATOM records):

>d1l8na2 d.92.2.2 (A:4-142) alpha-D-glucuronidase, N-terminal domain {Bacillus stearothermophilus}
gyepcwlryerkdqysrlrfeeivakrtspifqaaveelqkglrsmmeiepqvvqevnet
ansiwlgtledeeferplegtlvhpegyvirsdvdpfriyiigktdagvlygvfhflrll
qmgeniaqlsiieqpkn

Timeline for d1l8na2:

• d1l8na2 is new in SCOP 1.65
  
• d1l8na2 appears in SCOP 1.67
  
• d1l8na2 appears in the current release, SCOPe 2.08