Lineage for d1l8ik_ (1l8i K:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1484439Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1484862Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 1484885Species Escherichia coli, Dps [TaxId:562] [47251] (7 PDB entries)
    ferritin homolog that binds to and protects DNA
  8. 1484956Domain d1l8ik_: 1l8i K: [84560]
    complexed with k, trs

Details for d1l8ik_

PDB Entry: 1l8i (more details), 3 Å

PDB Description: dna protection and binding by e. coli dps protein
PDB Compounds: (K:) DNA protection during starvation protein

SCOPe Domain Sequences for d1l8ik_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l8ik_ a.25.1.1 (K:) Dodecameric ferritin homolog {Escherichia coli, Dps [TaxId: 562]}
tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
vrkaigeakdddtadiltaasrdldkflwfiesnie

SCOPe Domain Coordinates for d1l8ik_:

Click to download the PDB-style file with coordinates for d1l8ik_.
(The format of our PDB-style files is described here.)

Timeline for d1l8ik_: