Class a: All alpha proteins [46456] (258 folds) |
Fold a.25: Ferritin-like [47239] (4 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (5 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (9 proteins) |
Protein Dodecameric ferritin homolog [47250] (13 species) |
Species Escherichia coli, Dps [TaxId:562] [47251] (7 PDB entries) ferritin homolog that binds to and protects DNA |
Domain d1l8ih_: 1l8i H: [84557] |
PDB Entry: 1l8i (more details), 3 Å
SCOP Domain Sequences for d1l8ih_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l8ih_ a.25.1.1 (H:) Dodecameric ferritin homolog {Escherichia coli, Dps [TaxId: 562]} nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta lichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv rkaigeakdddtadiltaasrdldkflwfiesnie
Timeline for d1l8ih_: