Lineage for d1l8ie_ (1l8i E:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 638520Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 638728Protein Dodecameric ferritin homolog [47250] (13 species)
  7. 638772Species Escherichia coli, Dps [TaxId:562] [47251] (7 PDB entries)
    ferritin homolog that binds to and protects DNA
  8. 638837Domain d1l8ie_: 1l8i E: [84554]

Details for d1l8ie_

PDB Entry: 1l8i (more details), 3 Å

PDB Description: Dna Protection and Binding by E. Coli DPS Protein
PDB Compounds: (E:) DNA protection during starvation protein

SCOP Domain Sequences for d1l8ie_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l8ie_ a.25.1.1 (E:) Dodecameric ferritin homolog {Escherichia coli, Dps [TaxId: 562]}
tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
vrkaigeakdddtadiltaasrdldkflwfiesnie

SCOP Domain Coordinates for d1l8ie_:

Click to download the PDB-style file with coordinates for d1l8ie_.
(The format of our PDB-style files is described here.)

Timeline for d1l8ie_: