Lineage for d1l8ie_ (1l8i E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2701715Protein Dodecameric ferritin homolog [47250] (16 species)
  7. 2701766Species Escherichia coli, Dps [TaxId:562] [47251] (8 PDB entries)
    ferritin homolog that binds to and protects DNA
  8. 2701843Domain d1l8ie_: 1l8i E: [84554]
    complexed with k, trs

Details for d1l8ie_

PDB Entry: 1l8i (more details), 3 Å

PDB Description: dna protection and binding by e. coli dps protein
PDB Compounds: (E:) DNA protection during starvation protein

SCOPe Domain Sequences for d1l8ie_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l8ie_ a.25.1.1 (E:) Dodecameric ferritin homolog {Escherichia coli, Dps [TaxId: 562]}
tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
vrkaigeakdddtadiltaasrdldkflwfiesnie

SCOPe Domain Coordinates for d1l8ie_:

Click to download the PDB-style file with coordinates for d1l8ie_.
(The format of our PDB-style files is described here.)

Timeline for d1l8ie_: