SCOP 1.65: Domain d1l3ta1: 1l3t A:297-468

Lineage for d1l3ta1 (1l3t A:297-468)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (7 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (6 proteins)

6. Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
   part of Klenow fragment, KF

7. Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (10 PDB entries)

8. Domain d1l3ta1: 1l3t A:297-468 [84523]
   Other proteins in same PDB: d1l3ta2
   complexed with mg, so4, suc

Details for d1l3ta1

PDB Entry: 1l3t, 1.7 Å

PDB Description: crystal structure of bacillus dna polymerase i fragment product complex with 10 base pairs of duplex dna following addition of a single dttp residue

SCOP Domain Sequences for d1l3ta1:

Sequence; same for both SEQRES and ATOM records:

>d1l3ta1 c.55.3.5 (A:297-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed}
akmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

Timeline for d1l3ta1:

• d1l3ta1 is new in SCOP 1.65
  
• d1l3ta1 appears in SCOP 1.67
  
• d1l3ta1 appears in the current release, SCOPe 2.08