Lineage for d1l0nk_ (1l0n K:)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 340729Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
    not a true fold
  4. 340973Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family) (S)
  5. 340974Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (1 protein)
  6. 340975Protein Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81516] (1 species)
    the smallest subunit of the complex, interacts with subunit 10 and ISP, peripherally located
  7. 340976Species Cow (Bos taurus) [TaxId:9913] [81515] (5 PDB entries)
  8. 340978Domain d1l0nk_: 1l0n K: [84513]
    Other proteins in same PDB: d1l0na1, d1l0na2, d1l0nb1, d1l0nb2, d1l0nc1, d1l0nc2, d1l0nd1, d1l0nd2, d1l0ne1, d1l0ne2, d1l0nf_, d1l0ng_, d1l0nh_, d1l0ni_, d1l0nj_
    complexed with fes, hem

Details for d1l0nk_

PDB Entry: 1l0n (more details), 2.6 Å

PDB Description: native structure of bovine mitochondrial cytochrome bc1 complex
PDB Compounds: (K:)

SCOP Domain Sequences for d1l0nk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0nk_ f.23.15.1 (K:) Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)}
mltrflgpryrqlarnwvptaqlwgavgavglvsatdsrlildwvptin

SCOP Domain Coordinates for d1l0nk_:

Click to download the PDB-style file with coordinates for d1l0nk_.
(The format of our PDB-style files is described here.)

Timeline for d1l0nk_: