Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) |
Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (1 protein) |
Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species) together with cytochrome b binds to ubiquinone |
Species Cow (Bos taurus) [TaxId:9913] [81503] (18 PDB entries) |
Domain d1l0ng_: 1l0n G: [84509] Other proteins in same PDB: d1l0na1, d1l0na2, d1l0nb1, d1l0nb2, d1l0nc1, d1l0nc2, d1l0nd1, d1l0nd2, d1l0ne1, d1l0ne2, d1l0nf_, d1l0nh_, d1l0ni_, d1l0nj_, d1l0nk_ complexed with fes, hem |
PDB Entry: 1l0n (more details), 2.6 Å
SCOP Domain Sequences for d1l0ng_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0ng_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]} grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt wgtqefekskrknpa
Timeline for d1l0ng_: