Lineage for d1l0ne1 (1l0n E:70-196)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 795913Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 795914Superfamily b.33.1: ISP domain [50022] (3 families) (S)
  5. 795915Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (8 proteins)
  6. 795938Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (3 species)
  7. 795959Species Cow (Bos taurus) [TaxId:9913] [50025] (10 PDB entries)
  8. 795964Domain d1l0ne1: 1l0n E:70-196 [84506]
    Other proteins in same PDB: d1l0na1, d1l0na2, d1l0nb1, d1l0nb2, d1l0nc1, d1l0nc2, d1l0nd1, d1l0nd2, d1l0ne2, d1l0nf_, d1l0ng_, d1l0nh_, d1l0ni_, d1l0nj_, d1l0nk_
    complexed with fes, hem

Details for d1l0ne1

PDB Entry: 1l0n (more details), 2.6 Å

PDB Description: native structure of bovine mitochondrial cytochrome bc1 complex
PDB Compounds: (E:) ubiquinol-cytochrome c reductase iron-sulfur subunit

SCOP Domain Sequences for d1l0ne1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0ne1 b.33.1.1 (E:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus) [TaxId: 9913]}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg

SCOP Domain Coordinates for d1l0ne1:

Click to download the PDB-style file with coordinates for d1l0ne1.
(The format of our PDB-style files is described here.)

Timeline for d1l0ne1: