SCOP 1.65: Domain d1l0nc2: 1l0n C:3-260

Lineage for d1l0nc2 (1l0n C:3-260)

1. Root: SCOP 1.65

2. Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (2 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families)
   Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically

5. Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (1 protein)
   a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species)
   also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits

7. Species Cow (Bos taurus) [TaxId:9913] [81638] (5 PDB entries)

8. Domain d1l0nc2: 1l0n C:3-260 [84503]
   Other proteins in same PDB: d1l0na1, d1l0na2, d1l0nb1, d1l0nb2, d1l0nc1, d1l0nd1, d1l0nd2, d1l0ne1, d1l0ne2, d1l0nf_, d1l0ng_, d1l0nh_, d1l0ni_, d1l0nj_, d1l0nk_
   complexed with fes, hem

Details for d1l0nc2

PDB Entry: 1l0n, 2.6 Å

PDB Description: native structure of bovine mitochondrial cytochrome bc1 complex

SCOP Domain Sequences for d1l0nc2:

Sequence; same for both SEQRES and ATOM records:

>d1l0nc2 f.21.1.2 (C:3-260) Mitochondrial cytochrome b subunit, N-terminal domain {Cow (Bos taurus)}
nirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttta
fssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilllt
vmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffafh
filpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalmll
vlfapdllgdpdnytpan

Timeline for d1l0nc2:

• d1l0nc2 is new in SCOP 1.65
  
• d1l0nc2 appears in SCOP 1.67
  
• d1l0nc2 appears in the current release, SCOPe 2.08