Lineage for d1l0nc2 (1l0n C:3-260)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024525Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 3024526Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 3024532Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 3024543Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species)
    also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits
  7. 3024565Species Cow (Bos taurus) [TaxId:9913] [81638] (19 PDB entries)
    Uniprot P00157
  8. 3024577Domain d1l0nc2: 1l0n C:3-260 [84503]
    Other proteins in same PDB: d1l0na1, d1l0na2, d1l0nb1, d1l0nb2, d1l0nc1, d1l0nd1, d1l0nd2, d1l0ne1, d1l0ne2, d1l0nf_, d1l0ng_, d1l0nh_, d1l0ni_, d1l0nj_, d1l0nk_
    complexed with fes, hem

Details for d1l0nc2

PDB Entry: 1l0n (more details), 2.6 Å

PDB Description: native structure of bovine mitochondrial cytochrome bc1 complex
PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d1l0nc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0nc2 f.21.1.2 (C:3-260) Mitochondrial cytochrome b subunit, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
nirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttta
fssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilllt
vmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffafh
filpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalmll
vlfapdllgdpdnytpan

SCOPe Domain Coordinates for d1l0nc2:

Click to download the PDB-style file with coordinates for d1l0nc2.
(The format of our PDB-style files is described here.)

Timeline for d1l0nc2: