![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
![]() | Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family) ![]() |
![]() | Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins) a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
![]() | Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81643] (18 PDB entries) Uniprot P00157 |
![]() | Domain d1l0nc1: 1l0n C:261-379 [84502] Other proteins in same PDB: d1l0na1, d1l0na2, d1l0nb1, d1l0nb2, d1l0nc2, d1l0nd1, d1l0nd2, d1l0ne1, d1l0ne2, d1l0nf_, d1l0ng_, d1l0nh_, d1l0ni_, d1l0nj_, d1l0nk_ complexed with fes, hem |
PDB Entry: 1l0n (more details), 2.6 Å
SCOPe Domain Sequences for d1l0nc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0nc1 f.32.1.1 (C:261-379) Mitochondrial cytochrome b subunit, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]} plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw
Timeline for d1l0nc1: