SCOP 1.65: Domain d1l0nc1: 1l0n C:261-379

Lineage for d1l0nc1 (1l0n C:261-379)

1. Root: SCOP 1.65

2. Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)

3. Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
   core: three transmembrane helices, up-and-down bundle

4. Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family)

5. Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (1 protein)
   a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81643] (5 PDB entries)

8. Domain d1l0nc1: 1l0n C:261-379 [84502]
   Other proteins in same PDB: d1l0na1, d1l0na2, d1l0nb1, d1l0nb2, d1l0nc2, d1l0nd1, d1l0nd2, d1l0ne1, d1l0ne2, d1l0nf_, d1l0ng_, d1l0nh_, d1l0ni_, d1l0nj_, d1l0nk_
   complexed with fes, hem

Details for d1l0nc1

PDB Entry: 1l0n, 2.6 Å

PDB Description: native structure of bovine mitochondrial cytochrome bc1 complex

SCOP Domain Sequences for d1l0nc1:

Sequence; same for both SEQRES and ATOM records:

>d1l0nc1 f.32.1.1 (C:261-379) Mitochondrial cytochrome b subunit, C-terminal domain {Cow (Bos taurus)}
plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl
sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw

Timeline for d1l0nc1:

• d1l0nc1 is new in SCOP 1.65
  
• d1l0nc1 appears in SCOP 1.67
  
• d1l0nc1 appears in the current release, SCOPe 2.08