SCOPe 2.02: Domain d1l0nb2: 1l0n B:236-439

Lineage for d1l0nb2 (1l0n B:236-439)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (6 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 2 [63409] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56000] (18 PDB entries)
   Uniprot P23004

8. Domain d1l0nb2: 1l0n B:236-439 [84501]
   Other proteins in same PDB: d1l0na1, d1l0na2, d1l0nc1, d1l0nc2, d1l0nd1, d1l0nd2, d1l0ne1, d1l0ne2, d1l0nf_, d1l0ng_, d1l0nh_, d1l0ni_, d1l0nj_, d1l0nk_
   complexed with fes, hem

Details for d1l0nb2

PDB Entry: 1l0n, 2.6 Å

PDB Description: native structure of bovine mitochondrial cytochrome bc1 complex

PDB Compounds: (B:) ubiquinol-cytochrome c reductase complex core protein 2

SCOPe Domain Sequences for d1l0nb2:

Sequence; same for both SEQRES and ATOM records:

>d1l0nb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]}
kakyhggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatssl
yqavakgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnp
dvqaaknklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaak
kfvsgrksmaasgnlghtpfidel

Timeline for d1l0nb2:

• d1l0nb2 first appeared in SCOP 1.65
  
• d1l0nb2 appears in SCOPe 2.01
  
• d1l0nb2 appears in SCOPe 2.03
  
• d1l0nb2 appears in the current release, SCOPe 2.08