Lineage for d1l0na2 (1l0n A:234-446)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2562006Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 2562007Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 2562008Family d.185.1.1: MPP-like [63412] (7 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 2562009Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
  7. 2562038Species Cow (Bos taurus) [TaxId:9913] [55997] (18 PDB entries)
    Uniprot P31800
  8. 2562062Domain d1l0na2: 1l0n A:234-446 [84499]
    Other proteins in same PDB: d1l0nb1, d1l0nb2, d1l0nc1, d1l0nc2, d1l0nd1, d1l0nd2, d1l0ne1, d1l0ne2, d1l0nf_, d1l0ng_, d1l0nh_, d1l0ni_, d1l0nj_, d1l0nk_
    complexed with fes, hem

Details for d1l0na2

PDB Entry: 1l0n (more details), 2.6 Å

PDB Description: native structure of bovine mitochondrial cytochrome bc1 complex
PDB Compounds: (A:) ubiquinol-cytochrome c reductase complex core protein I

SCOPe Domain Sequences for d1l0na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0na2 d.185.1.1 (A:234-446) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]}
crftgsqichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssp
lasiaatnklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatese
vlrgknllrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcsk
yfydqcpavagfgpieqlpdynrirsgmfwlrf

SCOPe Domain Coordinates for d1l0na2:

Click to download the PDB-style file with coordinates for d1l0na2.
(The format of our PDB-style files is described here.)

Timeline for d1l0na2: