SCOPe 2.08: Domain d1l0lk_: 1l0l K:

Lineage for d1l0lk_ (1l0l K:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family)
   automatically mapped to Pfam PF08997

5. Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (2 proteins)

6. Protein Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81516] (1 species)
   the smallest subunit of the complex, interacts with subunit 10 and ISP, peripherally located

7. Species Cow (Bos taurus) [TaxId:9913] [81515] (12 PDB entries)
   Uniprot P07552

8. Domain d1l0lk_: 1l0l K: [84497]
   Other proteins in same PDB: d1l0la1, d1l0la2, d1l0lb1, d1l0lb2, d1l0lc1, d1l0lc2, d1l0ld1, d1l0ld2, d1l0le1, d1l0le2, d1l0lf_, d1l0lg_, d1l0lh_, d1l0li_, d1l0lj_
   complexed with fes, fmx, hem

Details for d1l0lk_

PDB Entry: 1l0l, 2.35 Å

PDB Description: structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone

PDB Compounds: (K:) Ubiquinol-cytochrome c reductase complex 6.4 kDa protein

SCOPe Domain Sequences for d1l0lk_:

Sequence; same for both SEQRES and ATOM records:

>d1l0lk_ f.23.15.1 (K:) Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
mltrflgpryrqlarnwvptaqlwgavgavglvwatdwrlildwvpyingkfk

Timeline for d1l0lk_:

• d1l0lk_ first appeared in SCOP 1.65
  
• d1l0lk_ appears in SCOPe 2.07