Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) |
Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (1 protein) |
Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species) together with cytochrome b binds to ubiquinone |
Species Cow (Bos taurus) [TaxId:9913] [81503] (18 PDB entries) |
Domain d1l0lg_: 1l0l G: [84493] Other proteins in same PDB: d1l0la1, d1l0la2, d1l0lb1, d1l0lb2, d1l0lc1, d1l0lc2, d1l0ld1, d1l0ld2, d1l0le1, d1l0le2, d1l0lf_, d1l0lh_, d1l0li_, d1l0lj_, d1l0lk_ complexed with fes, fmx, hem |
PDB Entry: 1l0l (more details), 2.35 Å
SCOP Domain Sequences for d1l0lg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0lg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]} grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt wgtqefekskrknpaayen
Timeline for d1l0lg_: