Lineage for d1l0lf_ (1l0l F:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1699236Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 1699237Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
    automatically mapped to Pfam PF02271
  5. 1699238Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 1699239Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)
  7. 1699250Species Cow (Bos taurus) [TaxId:9913] [81519] (14 PDB entries)
    Uniprot P00129
  8. 1699256Domain d1l0lf_: 1l0l F: [84492]
    Other proteins in same PDB: d1l0la1, d1l0la2, d1l0lb1, d1l0lb2, d1l0lc1, d1l0lc2, d1l0ld1, d1l0ld2, d1l0le1, d1l0le2, d1l0lg_, d1l0lh_, d1l0li_, d1l0lj_, d1l0lk_
    complexed with fes, fmx, hem

Details for d1l0lf_

PDB Entry: 1l0l (more details), 2.35 Å

PDB Description: structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
PDB Compounds: (F:) Ubiquinol-cytochrome c reductase complex 14 kDa protein

SCOPe Domain Sequences for d1l0lf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0lf_ f.27.1.1 (F:) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
grpavsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfr
ikraldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk

SCOPe Domain Coordinates for d1l0lf_:

Click to download the PDB-style file with coordinates for d1l0lf_.
(The format of our PDB-style files is described here.)

Timeline for d1l0lf_: