SCOP 1.73: Domain d1l0lf_: 1l0l F:

Lineage for d1l0lf_ (1l0l F:)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family)
   location - matrix side of the bc1 complex

5. Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (1 protein)
   probably important for the complex assembly, caps the matrix face of cytochrome b

6. Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81519] (17 PDB entries)

8. Domain d1l0lf_: 1l0l F: [84492]
   Other proteins in same PDB: d1l0la1, d1l0la2, d1l0lb1, d1l0lb2, d1l0lc1, d1l0lc2, d1l0ld1, d1l0ld2, d1l0le1, d1l0le2, d1l0lg_, d1l0lh_, d1l0li_, d1l0lj_, d1l0lk_
   complexed with fes, fmx, hem

Details for d1l0lf_

PDB Entry: 1l0l, 2.35 Å

PDB Description: structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone

PDB Compounds: (F:) Ubiquinol-cytochrome c reductase complex 14 kDa protein

SCOP Domain Sequences for d1l0lf_:

Sequence; same for both SEQRES and ATOM records:

>d1l0lf_ f.27.1.1 (F:) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
grpavsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfr
ikraldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk

Timeline for d1l0lf_:

• d1l0lf_ first appeared in SCOP 1.65
  
• d1l0lf_ appears in SCOP 1.71
  
• d1l0lf_ appears in SCOP 1.75
  
• d1l0lf_ appears in the current release, SCOPe 2.08