Lineage for d1l0le2 (1l0l E:1-69)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059389Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1059867Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family) (S)
  5. 1059868Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 1059869Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)
  7. 1059885Species Cow (Bos taurus) [TaxId:9913] [81497] (12 PDB entries)
    Uniprot P13272; precursor of chains I,E and V,R
  8. 1059891Domain d1l0le2: 1l0l E:1-69 [84491]
    Other proteins in same PDB: d1l0la1, d1l0la2, d1l0lb1, d1l0lb2, d1l0lc1, d1l0lc2, d1l0ld1, d1l0ld2, d1l0le1, d1l0lf_, d1l0lg_, d1l0lh_, d1l0li_, d1l0lj_, d1l0lk_
    complexed with fes, fmx, hem

Details for d1l0le2

PDB Entry: 1l0l (more details), 2.35 Å

PDB Description: structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
PDB Compounds: (E:) ubiquinol-cytochrome c reductase iron-sulfur subunit

SCOPe Domain Sequences for d1l0le2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0le2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl

SCOPe Domain Coordinates for d1l0le2:

Click to download the PDB-style file with coordinates for d1l0le2.
(The format of our PDB-style files is described here.)

Timeline for d1l0le2: