| Class f: Membrane and cell surface proteins and peptides [56835] (36 folds) |
| Fold f.23: Single transmembrane helix [81407] (22 superfamilies) not a true fold |
Superfamily f.23.12: Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81502] (1 family) ![]() |
| Family f.23.12.1: Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81501] (1 protein) |
| Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species) |
| Species Cow (Bos taurus) [TaxId:9913] [81497] (5 PDB entries) |
| Domain d1l0le2: 1l0l E:1-69 [84491] Other proteins in same PDB: d1l0la1, d1l0la2, d1l0lb1, d1l0lb2, d1l0lc1, d1l0lc2, d1l0ld1, d1l0ld2, d1l0le1, d1l0lf_, d1l0lg_, d1l0lh_, d1l0li_, d1l0lj_, d1l0lk_ complexed with fes, fmx, hem |
PDB Entry: 1l0l (more details), 2.35 Å
SCOP Domain Sequences for d1l0le2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0le2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus)}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl
Timeline for d1l0le2: