![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (2 families) ![]() |
![]() | Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (8 proteins) |
![]() | Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [50025] (10 PDB entries) |
![]() | Domain d1l0le1: 1l0l E:70-196 [84490] Other proteins in same PDB: d1l0la1, d1l0la2, d1l0lb1, d1l0lb2, d1l0lc1, d1l0lc2, d1l0ld1, d1l0ld2, d1l0le2, d1l0lf_, d1l0lg_, d1l0lh_, d1l0li_, d1l0lj_, d1l0lk_ complexed with fes, fmx, hem |
PDB Entry: 1l0l (more details), 2.35 Å
SCOP Domain Sequences for d1l0le1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0le1 b.33.1.1 (E:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus) [TaxId: 9913]} amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts ddmvivg
Timeline for d1l0le1: