Lineage for d1l0le1 (1l0l E:70-196)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 295512Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 295513Superfamily b.33.1: ISP domain [50022] (2 families) (S)
  5. 295514Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (6 proteins)
  6. 295526Protein ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain [50024] (3 species)
  7. 295537Species Cow (Bos taurus) [TaxId:9913] [50025] (6 PDB entries)
  8. 295539Domain d1l0le1: 1l0l E:70-196 [84490]
    Other proteins in same PDB: d1l0la1, d1l0la2, d1l0lb1, d1l0lb2, d1l0lc1, d1l0lc2, d1l0ld1, d1l0ld2, d1l0le2, d1l0lf_, d1l0lg_, d1l0lh_, d1l0li_, d1l0lj_, d1l0lk_
    complexed with fes, fmx, hem

Details for d1l0le1

PDB Entry: 1l0l (more details), 2.35 Å

PDB Description: structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone

SCOP Domain Sequences for d1l0le1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0le1 b.33.1.1 (E:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain {Cow (Bos taurus)}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg

SCOP Domain Coordinates for d1l0le1:

Click to download the PDB-style file with coordinates for d1l0le1.
(The format of our PDB-style files is described here.)

Timeline for d1l0le1: