Class a: All alpha proteins [46456] (289 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins) |
Protein Cytochrome bc1 domain [46677] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [46678] (18 PDB entries) Uniprot P00125 |
Domain d1l0ld1: 1l0l D:1-195 [84488] Other proteins in same PDB: d1l0la1, d1l0la2, d1l0lb1, d1l0lb2, d1l0lc1, d1l0lc2, d1l0ld2, d1l0le1, d1l0le2, d1l0lf_, d1l0lg_, d1l0lh_, d1l0li_, d1l0lj_, d1l0lk_ complexed with fes, fmx, hem |
PDB Entry: 1l0l (more details), 2.35 Å
SCOPe Domain Sequences for d1l0ld1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0ld1 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus) [TaxId: 9913]} sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms qvakdvctflrwaae
Timeline for d1l0ld1: