Lineage for d1l0ld1 (1l0l D:1-195)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257168Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1257169Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1257611Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)
  6. 1257612Protein Cytochrome bc1 domain [46677] (3 species)
  7. 1257628Species Cow (Bos taurus) [TaxId:9913] [46678] (18 PDB entries)
    Uniprot P00125
  8. 1257637Domain d1l0ld1: 1l0l D:1-195 [84488]
    Other proteins in same PDB: d1l0la1, d1l0la2, d1l0lb1, d1l0lb2, d1l0lc1, d1l0lc2, d1l0ld2, d1l0le1, d1l0le2, d1l0lf_, d1l0lg_, d1l0lh_, d1l0li_, d1l0lj_, d1l0lk_
    complexed with fes, fmx, hem

Details for d1l0ld1

PDB Entry: 1l0l (more details), 2.35 Å

PDB Description: structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
PDB Compounds: (D:) cytochrome c1, heme protein

SCOPe Domain Sequences for d1l0ld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0ld1 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus) [TaxId: 9913]}
sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
qvakdvctflrwaae

SCOPe Domain Coordinates for d1l0ld1:

Click to download the PDB-style file with coordinates for d1l0ld1.
(The format of our PDB-style files is described here.)

Timeline for d1l0ld1: