Lineage for d1l0lb1 (1l0l B:17-235)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879393Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 879394Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 879395Family d.185.1.1: MPP-like [63412] (6 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 879470Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
  7. 879513Species Cow (Bos taurus) [TaxId:9913] [56000] (12 PDB entries)
    Uniprot P23004
  8. 879526Domain d1l0lb1: 1l0l B:17-235 [84484]
    Other proteins in same PDB: d1l0la1, d1l0la2, d1l0lc1, d1l0lc2, d1l0ld1, d1l0ld2, d1l0le1, d1l0le2, d1l0lf_, d1l0lg_, d1l0lh_, d1l0li_, d1l0lj_, d1l0lk_

Details for d1l0lb1

PDB Entry: 1l0l (more details), 2.35 Å

PDB Description: structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
PDB Compounds: (B:) ubiquinol-cytochrome c reductase complex core protein 2

SCOP Domain Sequences for d1l0lb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0lb1 d.185.1.1 (B:17-235) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]}
vpphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslt
tkgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwe
vaalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvq
nhftsarmaliglgvshpvlkqvaeqflnirgglglsga

SCOP Domain Coordinates for d1l0lb1:

Click to download the PDB-style file with coordinates for d1l0lb1.
(The format of our PDB-style files is described here.)

Timeline for d1l0lb1: