| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) ![]() |
| Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein) contains additional N-terminal helix that forms a separate unit automatically mapped to Pfam PF00312 |
| Protein Ribosomal protein S15 [47065] (3 species) |
| Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries) Uniprot P80378 |
| Domain d1kuqa_: 1kuq A: [84470] complex with an rRNA fragment protein/RNA complex; complexed with so4; mutant |
PDB Entry: 1kuq (more details), 2.84 Å
SCOPe Domain Sequences for d1kuqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kuqa_ a.16.1.2 (A:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
ckeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvgqr
rrllrylqredperyralieklgi
Timeline for d1kuqa_: