Lineage for d1kpvb_ (1kpv B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1290588Protein beta2-microglobulin [88600] (5 species)
  7. 1291129Species Mouse (Mus musculus) [TaxId:10090] [88603] (155 PDB entries)
    Uniprot P01887
  8. 1291140Domain d1kpvb_: 1kpv B: [84461]
    Other proteins in same PDB: d1kpva1, d1kpva2
    complexed with mpd, po4

Details for d1kpvb_

PDB Entry: 1kpv (more details), 1.71 Å

PDB Description: high resolution crystal structure of the mhc class i complex h- 2kb/sev9
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d1kpvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpvb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws
fyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1kpvb_:

Click to download the PDB-style file with coordinates for d1kpvb_.
(The format of our PDB-style files is described here.)

Timeline for d1kpvb_: