SCOPe 2.01: Domain d1kpvb_: 1kpv B:

Lineage for d1kpvb_ (1kpv B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (142 PDB entries)
   Uniprot P01887

8. Domain d1kpvb_: 1kpv B: [84461]
   Other proteins in same PDB: d1kpva1, d1kpva2
   complexed with mpd, po4

Details for d1kpvb_

PDB Entry: 1kpv, 1.71 Å

PDB Description: high resolution crystal structure of the mhc class i complex h- 2kb/sev9

PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d1kpvb_:

Sequence; same for both SEQRES and ATOM records:

>d1kpvb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws
fyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1kpvb_:

• d1kpvb_ first appeared in SCOP 1.65
  
• d1kpvb_ appears in SCOP 1.75
  
• d1kpvb_ appears in SCOPe 2.02
  
• d1kpvb_ appears in the current release, SCOPe 2.08