Lineage for d1kpva2 (1kpv A:1-181)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198031Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1198345Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (40 PDB entries)
    Uniprot P01901 22-299
  8. 1198351Domain d1kpva2: 1kpv A:1-181 [84460]
    Other proteins in same PDB: d1kpva1, d1kpvb_
    complexed with mpd, po4

Details for d1kpva2

PDB Entry: 1kpv (more details), 1.71 Å

PDB Description: high resolution crystal structure of the mhc class i complex h- 2kb/sev9
PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d1kpva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpva2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOPe Domain Coordinates for d1kpva2:

Click to download the PDB-style file with coordinates for d1kpva2.
(The format of our PDB-style files is described here.)

Timeline for d1kpva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kpva1
View in 3D
Domains from other chains:
(mouse over for more information)
d1kpvb_