SCOP 1.71: Domain d1kpua2: 1kpu A:1-181

Lineage for d1kpua2 (1kpu A:1-181)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (40 PDB entries)

8. Domain d1kpua2: 1kpu A:1-181 [84457]
   Other proteins in same PDB: d1kpua1, d1kpub_
   complexed with fuc, mpd, nag

Details for d1kpua2

PDB Entry: 1kpu, 1.5 Å

PDB Description: high resolution crystal structure of the mhc class i complex h- 2kb/vsv8

SCOP Domain Sequences for d1kpua2:

Sequence; same for both SEQRES and ATOM records:

>d1kpua2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

Timeline for d1kpua2:

• d1kpua2 first appeared in SCOP 1.65
  
• d1kpua2 appears in SCOP 1.69
  
• d1kpua2 appears in SCOP 1.73
  
• d1kpua2 appears in the current release, SCOPe 2.08