Lineage for d1kkga_ (1kkg A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328444Fold d.52: Alpha-lytic protease prodomain-like [54805] (7 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 328521Superfamily d.52.7: Ribosome-binding factor A, RbfA [89919] (1 family) (S)
    possible distant homologue of the type I KH domain lacking the KH motif
  5. 328522Family d.52.7.1: Ribosome-binding factor A, RbfA [89920] (1 protein)
  6. 328523Protein Ribosome-binding factor A, RbfA [89921] (2 species)
  7. 328524Species Escherichia coli [TaxId:562] [89922] (1 PDB entry)
  8. 328525Domain d1kkga_: 1kkg A: [84411]
    structural genomics

Details for d1kkga_

PDB Entry: 1kkg (more details)

PDB Description: nmr structure of ribosome-binding factor a (rbfa)

SCOP Domain Sequences for d1kkga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kkga_ d.52.7.1 (A:) Ribosome-binding factor A, RbfA {Escherichia coli}
makefgrpqrvaqemqkeialilqreikdprlgmmttvsgvemsrdlayakvyvtflndk
dedavkagikalqeasgfirsllgkamrlrivpeltffydnslvegmr

SCOP Domain Coordinates for d1kkga_:

Click to download the PDB-style file with coordinates for d1kkga_.
(The format of our PDB-style files is described here.)

Timeline for d1kkga_: